DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CELA1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:274 Identity:83/274 - (30%)
Similarity:123/274 - (44%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRG----EHYCGGVIISAT 70
            :|:|.|...   ||:.:..:      |:|||.:|.:..:|.||||:.|.    .|.|||.:|...
Human     1 MLVLYGHST---QDLPETNA------RVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQN 56

  Fly    71 HVITAGHCVKHGNDVVPADLWSIQAGSLLLS-SDGVR--IPVAEVIMHP-----NYATGGHNDLA 127
            .|:||.|||.:      ...:.:.||...|| :||..  :.|.::::||     |.|.|  .|:|
Human    57 WVMTAAHCVDY------QKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAG--YDIA 113

  Fly   128 VLRLQSPLTFDANI--------AAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSIS 184
            :|||...:|.::.:        .|| ||...|  |.   |:|||.....|.|:.:|....:.|:.
Human   114 LLRLAQSVTLNSYVQLGVLPQEGAI-LANNSP--CY---ITGWGKTKTNGQLAQTLQQAYLPSVD 172

  Fly   185 RGACRWMFY--SRLPETMICLLHSKNSGACYGDSGGP--ATYGGK--VVGLASLLLGGGCG-RAA 242
            ...|....|  |.:..||:|.........|.||||||  ....||  |.|:.|.:...||. ...
Human   173 YAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRK 237

  Fly   243 PDGYLRISKVRAWI 256
            |..:.::|...:||
Human   238 PTVFTQVSAYISWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/246 (31%)
Tryp_SPc 37..219 CDD:238113 64/203 (32%)
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.