DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prtn3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:236 Identity:66/236 - (27%)
Similarity:108/236 - (45%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLR---GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            :||||.:|:....|:..||:|.   |.|:|||.:|....|:||.||::   |:    .|.:....
Mouse    29 KIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQ---DI----SWQLVTVV 86

  Fly    98 L----LLSS--DGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDP----- 151
            |    ||||  :..:..:::|..:........||:.:|:|....:....:|...|..:|.     
Mouse    87 LGAHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLLQLNRTASLGKEVAVASLPQQDQTLSQG 151

  Fly   152 PNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMIC-LLHSKNSGACYGD 215
            ..|:|:   |||.:..:.|....|..:.||.:: ..||        |..:| |:..:.:|.|:||
Mouse   152 TQCLAM---GWGRLGTQAPTPRVLQELNVTVVT-FLCR--------EHNVCTLVPRRAAGICFGD 204

  Fly   216 SGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ||||....|.:.|:.|.::........||.:.|:|....||
Mouse   205 SGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/234 (27%)
Tryp_SPc 37..219 CDD:238113 55/196 (28%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 64/234 (27%)
Tryp_SPc 30..248 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.