DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsb2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:272 Identity:76/272 - (27%)
Similarity:125/272 - (45%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE---HYCGGVI 66
            ||.:.||    ..::.......||...     ||||.:|.:.::|.|:|||.:..   |:|||.:
Mouse     9 LWALSLL----ASLVYSAPRPANQRVG-----IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSL 64

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATG-GHNDLAVLR 130
            |....|:||.|||  |..:....|:.:|.....|......:.:..:::||:|.|. |..|:|:|.
Mouse    65 IHPQWVLTAAHCV--GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLE 127

  Fly   131 LQSPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNIAEKGPLSD--SLLFVQVTSISRGACRWM 191
            |:.|:....::..|.|  |:|..|...:..::|||:|....||..  .|..|:|..:....|...
Mouse   128 LEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRK 192

  Fly   192 FYSRL---------PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDG-- 245
            :::.|         .:.|:|..:::.. :|.||||||.....|...|.:.::..|.|.|.|:.  
Mouse   193 YHTGLYTGDDFPIVHDGMLCAGNTRRD-SCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPG 256

  Fly   246 -YLRISKVRAWI 256
             |.|::....||
Mouse   257 IYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/239 (28%)
Tryp_SPc 37..219 CDD:238113 58/198 (29%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.