DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CFD

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:271 Identity:77/271 - (28%)
Similarity:119/271 - (43%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEP---RIVGGIKAKQGQFPHQISLRLRGEHYCGGVII 67
            |..|.:|     |:||......::.:...|   ||:||.:|:....|:..|::|.|.|.||||::
Human     4 WERLAVL-----VLLGAAACGEEAWAWAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLV 63

  Fly    68 SATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP--------VAEVIMHPNYA--TGG 122
            :...|::|.||::...|      ..:|   :||.:..:..|        |...:.||:..  |..
Human    64 AEQWVLSAAHCLEDAAD------GKVQ---VLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTID 119

  Fly   123 HNDLAVLRLQSPLTFDANIAAI--QLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISR 185
            | ||.:|:|....|....:..:  |....|.......|::|||.:...|...|||..|.:..:.|
Human   120 H-DLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDR 183

  Fly   186 GAC--RWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG--CG-RAAPDG 245
            ..|  |......:.|.::| ..|....:|.||||||...||.:.|:.:   .|.  || |..|..
Human   184 ATCNRRTHHDGAITERLMC-AESNRRDSCKGDSGGPLVCGGVLEGVVT---SGSRVCGNRKKPGI 244

  Fly   246 YLRISKVRAWI 256
            |.|::...|||
Human   245 YTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/236 (29%)
Tryp_SPc 37..219 CDD:238113 54/195 (28%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 68/236 (29%)
Tryp_SPc 33..258 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.