DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034769.4 Gene:Klk1 / 16612 MGIID:102850 Length:261 Species:Mus musculus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:109/246 - (44%) Gaps:31/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            ::.|||||...::...|.|:::....::.|||::::|..|:||.||  | ||  ...:|..:...
Mouse    21 VQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHC--H-ND--KYQVWLGKNNF 80

  Fly    98 LLLSSDGVRIPVAEVIMHPNY---ATGGH---------NDLAVLRLQSPLTFDANIAAIQLATED 150
            |..........|::.|.||::   ....|         |||.:|||:.|......:..|.|.||:
Mouse    81 LEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEE 145

  Fly   151 P---PNCVAVDISGWGNIAE-KGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSG- 210
            |   ..|:|   ||||:|.. |....|.|..|.:..:....|......::.:.|:| ....:.| 
Mouse   146 PKLGSTCLA---SGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLC-AGDMDGGK 206

  Fly   211 -ACYGDSGGPATYGGKVVGLASLLLG-GGCGRA-APDGYLRISKVRAWIAE 258
             .|.||||||....|.:.|:.|  .| ..||:. .|..|.|:.....||.|
Mouse   207 DTCAGDSGGPLICDGVLQGITS--WGPSPCGKPNVPGIYTRVLNFNTWIRE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/239 (29%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
Klk1NP_034769.4 Tryp_SPc 24..253 CDD:214473 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.