DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:245 Identity:84/245 - (34%)
Similarity:118/245 - (48%) Gaps:21/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSI 93
            :.:...||||||..:...|:|.|:||:.:|.|.|||.||:...::||.|||   .|:.....|::
Mouse   231 TRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCV---YDLYHPKSWTV 292

  Fly    94 QAGSLLLSSDGVRIPVAE-VIMHPNY---ATGGHNDLAVLRLQSPLTFDANIAAIQL--ATEDPP 152
            |.|.:.|....|...:.| :|.|..|   ..|  ||:|:::|..|||||..|..|.|  :.|:.|
Mouse   293 QVGLVSLMDSPVPSHLVEKIIYHSKYKPKRLG--NDIALMKLSEPLTFDETIQPICLPNSEENFP 355

  Fly   153 NCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC--RWMFYSRLPETMICLLHSKNS-GACYG 214
            :......||||...:.|..|..|....|..||...|  |.::...:..:|:|..:.|.. .:|.|
Mouse   356 DGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVDSCQG 420

  Fly   215 DSGGPATYG----GKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEK 259
            |||||....    .|:||..|  .|.||... .|..|.||:....||.|:
Mouse   421 DSGGPLVCQERRLWKLVGATS--FGIGCAEVNKPGVYTRITSFLDWIHEQ 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 80/233 (34%)
Tryp_SPc 37..219 CDD:238113 66/190 (35%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 0/1 (0%)
Tryp_SPc 238..465 CDD:214473 80/233 (34%)
Tryp_SPc 239..468 CDD:238113 81/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.