DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Cela2a

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:272 Identity:74/272 - (27%)
Similarity:127/272 - (46%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL----RGEHYCGGVII 67
            |:||..|....:..|....:.:.:.:   |:|||.:|....:|.|:||::    |..|.|||.::
Mouse     4 TLLLSALVAGALSCGYPTYEVEDDVS---RVVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLV 65

  Fly    68 SATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDG---VRIPVAEVIMHPNYAT---GGHNDL 126
            :...|:||.||:.:      ...:.:..|:..||:.|   ..:.|:::::|..:.:   |...|:
Mouse    66 ANNWVLTAAHCLSN------YQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDI 124

  Fly   127 AVLRLQSPLTFDANIAAIQL---ATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC 188
            |:::|.||:|...||....|   .|..|.|.|.. ::|||.:...|...|:|...::..:....|
Mouse   125 ALIKLASPVTLSKNIQTACLPPAGTILPRNYVCY-VTGWGLLQTNGNSPDTLRQGRLLVVDYATC 188

  Fly   189 ---RWMFYSRLPETMICLLHSKNSGACYGDSGGP----ATYG-GKVVGLASLLLGGGCG-RAAPD 244
               .| :.|.:..:|:|......:.:|.||||||    |:.| .:|.|:.|.....||. ...|.
Mouse   189 SSASW-WGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPS 252

  Fly   245 GYLRISKVRAWI 256
            .:.|:|....||
Mouse   253 VFTRVSNYIDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/241 (28%)
Tryp_SPc 37..219 CDD:238113 54/197 (27%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 67/241 (28%)
Tryp_SPc 31..267 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.