DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk1b22

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:250 Identity:72/250 - (28%)
Similarity:110/250 - (44%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            ::.||:||.|.::...|.|:::....|:.||||::....|:||.||.:        |.::|..|.
Mouse    21 VQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYE--------DKYNIWLGK 77

  Fly    98 LLLSSDGVRIP---VAEVIMHPNY--------ATGG--HNDLAVLRLQSPLTFDANIAAIQLATE 149
            ..|..|.....   |::...||::        .||.  .|||.:|||..|......:..|.|.|.
Mouse    78 NKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTT 142

  Fly   150 DP---PNCVAVDISGWGNIAE---KGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKN 208
            :|   ..|:|   ||||:|.:   :.|  :.|..|.:.......|......::.:.|:| ....|
Mouse   143 EPKLGSTCLA---SGWGSINQLIYQNP--NDLQCVSIKLHPNEVCVKAHILKVTDVMLC-AGEMN 201

  Fly   209 SG--ACYGDSGGPATYGGKVVGLASLLLGGG--CGRA-APDGYLRISKVRAWIAE 258
            .|  .|.||||||....|.:.|:.|   .|.  ||.. ||..|.::.|..:||.:
Mouse   202 GGKDTCKGDSGGPLICDGVLQGITS---WGSTPCGEPNAPAIYTKLIKFTSWIKD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/243 (29%)
Tryp_SPc 37..219 CDD:238113 57/202 (28%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 70/243 (29%)
Tryp_SPc 25..254 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.