DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:229 Identity:70/229 - (30%)
Similarity:110/229 - (48%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV---KHGNDVVPADLWSIQAGS 97
            |||||.|......|:|:|||....|.|||.|||.:.|:||.||:   .|.:::      :::.||
Mosquito    42 RIVGGSKTTIESVPYQVSLRYFNNHICGGSIISHSWVLTAAHCLDWYPHNDEI------TVRTGS 100

  Fly    98 LLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPNC-VAVDIS 160
            ...|:.|....|....:|..|...... |:|.:|:::|:...|..|.|.|||...... ..:.::
Mosquito   101 TSQSAGGSLHAVFYYHLHERYDPNEFQWDVATVRVRTPMGLGAGRAPIPLATSTEWTVGERILVT 165

  Fly   161 GWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGK 225
            |||.:...|.::|:|..:.:.::.:.:|...:...:...|:| .......||.|||||||...|.
Mosquito   166 GWGYLTAAGKVNDTLQMILLDAVPQESCNRTWTGFITADMLC-AGGPGVDACAGDSGGPAVQDGV 229

  Fly   226 VVGLASLLLGG-GCGRAAPDGYLRIS--KVRAWI 256
            ..|:.|  .|. .||...|..:..|:  .||::|
Mosquito   230 QYGIVS--WGSIDCGNGLPGVFTNIAHPSVRSFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/227 (30%)
Tryp_SPc 37..219 CDD:238113 55/186 (30%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 69/227 (30%)
Tryp_SPc 43..264 CDD:238113 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.