DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP001246

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_321901.4 Gene:AgaP_AGAP001246 / 1281921 VectorBaseID:AGAP001246 Length:283 Species:Anopheles gambiae


Alignment Length:280 Identity:86/280 - (30%)
Similarity:133/280 - (47%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLC--GVQVILGQDV-AQNQSESAIEP----------RIVGGIKAKQGQFPHQISLRLRGE 59
            ::||.||  ||.....||. |..|......|          |||||.:..: ..|:.:|||..|.
Mosquito    14 LVLLALCVAGVWSNEAQDAWASRQRRVQATPNGDGQKKFSGRIVGGTELTE-PLPYLLSLRDSGF 77

  Fly    60 HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLS--SDGVRIPVAEVIMHPNYATGG 122
            |.||..||:|.|.::|.||....:||   :..::.||....:  ::|:...||.|..||:::...
Mosquito    78 HICGASIINAKHALSAAHCQSPPSDV---NRLTLLAGITKRTDETNGILFKVANVTTHPDFSLKT 139

  Fly   123 H-NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVA--VDISGWGNIAEKGPLSDSLLFVQVTSIS 184
            : :|:|::|:.:......|:|||.|.:......|:  ..:||||..|:...|:.:|..|::..:|
Mosquito   140 YLSDVAIIRIVTSFLDHPNLAAIPLISTTYKLRVSSVASVSGWGLTAQDSMLAPTLRTVRIPIVS 204

  Fly   185 RGAC--RWMFYSRLP--ETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG-CGRAAPD 244
            ..:|  :|   ..:|  .|.||..| ....:|.||||||....|..:||.|  .|.. ||...|.
Mosquito   205 YSSCVNKW---RPVPIVWTAICAGH-PGRDSCNGDSGGPLVQDGVQIGLVS--WGADRCGSDYPG 263

  Fly   245 GYLRI--SKVRAWIAEKAGL 262
            .|..:  ..:|.:|.|.:|:
Mosquito   264 IYTYVGNKNIRKFIEENSGV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/231 (31%)
Tryp_SPc 37..219 CDD:238113 59/190 (31%)
AgaP_AGAP001246XP_321901.4 Tryp_SPc 55..270 CDD:214473 71/224 (32%)
Tryp_SPc 56..270 CDD:238113 70/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.