DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:252 Identity:62/252 - (24%)
Similarity:107/252 - (42%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRG--------EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSI 93
            |..|..|..|:|.|..::   |        :..|||.:|...:::||.||....:.::..|:  |
Mosquito    19 ISSGSPAFPGEFAHIAAI---GWTQPDGTVQWKCGGSLIWENYILTAAHCYADPDTILSPDV--I 78

  Fly    94 QAGSL-LLSSDGVRI----PVAEVIMHP-NYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPP 152
            :.|.| |..:|....    .:.::|.|| :.|:..:.|||:|:|...:.....:....|..:|..
Mosquito    79 RIGDLNLFDADDDEFVQERKIVQIIRHPLHNASTVYYDLALLKLDKKVIQSEGVIPTCLWLDDSI 143

  Fly   153 NCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSR--------LPETMICLLHSKNS 209
            ....::::|||........|:.||..::..::...|......|        |.:..:| ...:..
Mosquito   144 PFSTLEVAGWGQTGFGKEKSNMLLKAELKLMTNTECAKYNNKRTQRRLGNDLADHQLC-AWDEVM 207

  Fly   210 GACYGDSGGPATYG-----GKV---VGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            ..|.||||||..|.     .|:   ||:.|  .|..|..:.|..|::::|.:.||.|
Mosquito   208 DTCPGDSGGPLHYNLYYKHTKIPFLVGVTS--FGKACAVSQPGVYVKVAKFKQWIIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/248 (24%)
Tryp_SPc 37..219 CDD:238113 47/203 (23%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 62/252 (25%)
Tryp_SPc 19..260 CDD:214473 59/248 (24%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.