DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008994

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_319744.4 Gene:AgaP_AGAP008994 / 1279956 VectorBaseID:AGAP008994 Length:250 Species:Anopheles gambiae


Alignment Length:261 Identity:76/261 - (29%)
Similarity:119/261 - (45%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLR------LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQ 94
            |:|||..:|.|::|.|:.:|      |..::.||||:|:..:||||.||       .|..|.|:.
Mosquito     5 RVVGGKASKFGEWPWQVLVRESTWLGLFTKNKCGGVLITNEYVITAAHC-------QPGFLASLV 62

  Fly    95 A--GSLLLSSD-----GVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDP 151
            |  |...:|||     .|...|..||:|..| |....||||:|.|::|:.:|.:|.         
Mosquito    63 AVFGEFDISSDLETKRSVTKNVKRVIVHRQYDAATFENDLAILELENPIHYDVHIV--------- 118

  Fly   152 PNCVAVD----------ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-----SRLPETMI 201
            |.|:..|          ::|||.:...|.:...|..|||..|....|:.||:     .::..:.:
Mosquito   119 PICMPGDEADFTGRMATVTGWGRLTYGGGVPSVLQEVQVPVIENSVCQEMFHMAGHNKKILPSFV 183

  Fly   202 CLLHSKNS-GACYGDSGGPATY---GGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKAG 261
            |..::... .:|.||||||...   .|:...:.::..|..|... .|..|:|.:..:.|:....|
Mosquito   184 CAGYANGKRDSCEGDSGGPLVLQRPDGRYELVGTVSHGIRCAAPYLPGVYMRTTFYKPWLRSVTG 248

  Fly   262 L 262
            :
Mosquito   249 V 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/253 (29%)
Tryp_SPc 37..219 CDD:238113 65/211 (31%)
AgaP_AGAP008994XP_319744.4 Tryp_SPc 5..242 CDD:214473 74/252 (29%)
Tryp_SPc 6..246 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.