DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG43335

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:108/270 - (40%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            ||::.:          .|....||:||..|:....|....|.....::|.|.:|:...|:||.||
  Fly    29 CGIRTM----------PSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHC 83

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDGVR-------IPVAEVIMHPNYATGG--HNDLAVLRLQSP 134
            ::...::...     ..||.|..|||..       ..|:..|.| .|.|..  .||:|::||...
  Fly    84 IEASKNLTVR-----LGGSGLTRSDGSMCQITAEDYSVSMAIKH-KYFTPSIMLNDIAMIRLART 142

  Fly   135 LTFDANI--------AAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWM 191
            :.|..:|        .|::|..||....:|   :||| :|:|......|....:|.::|..|..:
  Fly   143 VKFYDHIRPICIILDPAVRLLLEDGMTLMA---TGWG-LADKRMHPHLLQEAPITVMNRNVCSKL 203

  Fly   192 FYSRLPETMICLLHSKNSGACYGDSGGPATYGGKV----------VGLASLLLGGGCGRAAPDGY 246
            :...:.:..|| ...|.:..|.||||||  .||.|          .|:.|.   |.....:|..|
  Fly   204 YDVAITQGQIC-AGDKETNTCLGDSGGP--LGGVVNYYGDLRFVQYGITSF---GDIECRSPSIY 262

  Fly   247 LRISKVRAWI 256
            ..:|....||
  Fly   263 TDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/246 (27%)
Tryp_SPc 37..219 CDD:238113 54/198 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 66/246 (27%)
Tryp_SPc 42..275 CDD:238113 67/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.