DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008861

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_319603.2 Gene:AgaP_AGAP008861 / 1279828 VectorBaseID:AGAP008861 Length:259 Species:Anopheles gambiae


Alignment Length:260 Identity:88/260 - (33%)
Similarity:123/260 - (47%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAG 76
            :|....|:....||......|...:||||......:.|:|||||..|...|||.|||...::||.
Mosquito     6 VLAFAMVVAVATVASGFVAPARRAQIVGGFPIDISEAPYQISLREGGHPSCGGSIISPDWILTAA 70

  Fly    77 HCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDAN 140
            ||:    :.|.||..||:|||......||...||.|::||.: ......|:|::.|:|||..|.:
Mosquito    71 HCL----EGVSADQVSIRAGSTYKMHGGVLRNVARVVLHPAWDPVTNEGDIALMELESPLPLDGD 131

  Fly   141 -IAAIQLA---TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVT---SISRGACRWMFYSR--- 195
             :|:|::.   .|||.......:||||....:   ..|.|.::.|   .:.|..|: ..|.|   
Mosquito   132 TMASIEMPEQDEEDPVEGSKALVSGWGKTLNR---FHSALILRATFLPIVHRDNCQ-KAYRRTHT 192

  Fly   196 LPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGR-AAPDGYLRISKVRAWIAE 258
            :.|.|:|. .......:|.||||||......:||:.|..:  ||.| ..|....|:|.||.||.|
Mosquito   193 ISEMMLCAGFFEGGHDSCQGDSGGPLVVDDVLVGVVSFAI--GCARPGLPGVNARVSAVRDWIRE 255

  Fly   259  258
            Mosquito   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 80/232 (34%)
Tryp_SPc 37..219 CDD:238113 67/193 (35%)
AgaP_AGAP008861XP_319603.2 Tryp_SPc 31..256 CDD:238113 83/235 (35%)
Tryp_SPc 31..253 CDD:214473 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.