DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:276 Identity:79/276 - (28%)
Similarity:129/276 - (46%) Gaps:31/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MW-TTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGG 64
            :| |||.:|.:|:...:..::|...:....:.....|||||:......:|:|:||| ||.|:||.
Mosquito     9 LWFTTLSSVTVLVSFTIVSVVGCSRSAENYDHTNGERIVGGVPVDIRDYPYQVSLR-RGRHFCGE 72

  Fly    65 VIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVL 129
            .||.:..::||.||.:..|   ..:|| |..||..::..|..:.|..::.||...:....|.::|
Mosquito    73 SIIDSQWILTAAHCTRTIN---ARNLW-IHVGSSHVNDGGESVRVRRILHHPKQNSWSDYDFSLL 133

  Fly   130 RLQSPLTFDANIAAIQL----ATE------DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSI- 183
            .|..||....::..|.|    |:|      |...|   .:|||||....   .:|.|.::..:: 
Mosquito   134 HLDQPLNLSESVQPIPLRKPSASEPTGELSDGTLC---KVSGWGNTHNP---DESALVLRAATVP 192

  Fly   184 --SRGACRWMF--YSRLPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA- 242
              :...|..::  ...:.|:|||..:.: ...:|.||||||....|::.|:.|  .|.||.... 
Mosquito   193 LTNHQQCSEVYEGIGSVTESMICAGYDEGGKDSCQGDSGGPLVCDGQLTGVVS--WGKGCAEPGY 255

  Fly   243 PDGYLRISKVRAWIAE 258
            |..|.::|....||.:
Mosquito   256 PGVYAKVSTAYEWIEQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/236 (30%)
Tryp_SPc 37..219 CDD:238113 58/197 (29%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 70/236 (30%)
Tryp_SPc 46..272 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.