DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004741

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_318080.4 Gene:AgaP_AGAP004741 / 1278484 VectorBaseID:AGAP004741 Length:315 Species:Anopheles gambiae


Alignment Length:294 Identity:84/294 - (28%)
Similarity:134/294 - (45%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAI---------EPR--------IVGGIKAKQGQFPHQISLR 55
            ::||.:||..::   .||.|::.|.:         .||        :|.|..|..||||.|.|:|
Mosquito    28 IVLLCICGTTIV---KVACNRTNSKLTAIPIPRHDAPRTVRELLAKVVNGQTATTGQFPWQASIR 89

  Fly    56 L---RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVI--MH 115
            .   |....|||.:|.|..|:||.||   .||..   ::.|..||:.|:.  .|:.::.||  :|
Mosquito    90 AALGRSVTVCGGSLIEAQWVLTAAHC---ANDYT---VFQIGLGSIHLNM--ARLTMSTVIKFVH 146

  Fly   116 PNY----ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCV----AVDISGWGNIAEK-GPL 171
            |.:    .|   ||:|::||.||:.:...|..::|....||..:    .|.:||:|..::. ..:
Mosquito   147 PEFDPWKLT---NDVALIRLPSPVPYSLEIYPVKLPINLPPTDLYIGRQVTVSGFGRTSDAIQSI 208

  Fly   172 SDSLLFVQVTSISRGACRWMFYSR-LPETMICLL--HSKNSGACYGDSGGPATY-----GGKVVG 228
            |..|.:.::..||...|..::.:. :..|.:|.:  .......|.||||||...     ....:|
Mosquito   209 STILKYERMRIISNAECTNVYGAAIIRNTTLCAVGWERPYQNVCQGDSGGPMVMQQDDSSWVQIG 273

  Fly   229 LASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262
            :.|.:...||....|.||:|.....:|:|:..||
Mosquito   274 IVSFVSSRGCSTGDPSGYIRTVNYLSWLAKTTGL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/249 (29%)
Tryp_SPc 37..219 CDD:238113 60/198 (30%)
AgaP_AGAP004741XP_318080.4 Tryp_SPc 70..300 CDD:214473 70/240 (29%)
Tryp_SPc 71..304 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.