DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:235 Identity:79/235 - (33%)
Similarity:120/235 - (51%) Gaps:23/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |:|||........|:|:|||...:|.|||.|::...::||.|||.: .::||:| :.::|||...
Mosquito    51 RVVGGSDTTIEAHPYQVSLRRLHKHSCGGAILNTNTILTAAHCVDY-PELVPSD-FEVRAGSTFR 113

  Fly   101 SSDGVRIPVAEVIMHPNYATGGHN------DLAVLRLQSPLTFDANIAAIQLATE--DPPNCVAV 157
            :..|..|.||::..||:|     |      |::||:|.|.|.....:..|.|...  ..|:..:|
Mosquito   114 NEGGQLITVAQIHTHPSY-----NDWTLEWDISVLKLVSSLQLSPTVQPISLPDRGLTIPDGTSV 173

  Fly   158 DISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETM---ICLLHSKNSGACYGDSGGP 219
            .::|||::..:||.::.|..|.:..:|...| .|.|......:   ||..| |...||.||||||
Mosquito   174 SLAGWGSLYYQGPSTNHLQHVMLPIVSNSRC-GMAYKNFAPILPFHICAGH-KGKDACQGDSGGP 236

  Fly   220 ATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
            ..|..:|||:.|  .|.||. ...|..|.|:|:...:|.:
Mosquito   237 LVYQSRVVGIVS--WGYGCAFENYPSVYTRVSEFLDFIGQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/231 (34%)
Tryp_SPc 37..219 CDD:238113 63/192 (33%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 78/231 (34%)
Tryp_SPc 52..272 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.