DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:238 Identity:77/238 - (32%)
Similarity:128/238 - (53%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |||||........|:||||:..|:|:|||.|:::..::||.||:...::|.|    :::.||...
Mosquito    46 RIVGGFVIDISDAPYQISLQYNGKHHCGGSILNSKWILTAAHCIDLYSEVKP----TVRVGSSEH 106

  Fly   101 SSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD------ 158
            ::.|..:.:..::.||.:::||:| |:|:|.|:..|||:.|:..:||..:|.|    :|      
Mosquito   107 AAGGTVLHLLRIVPHPGHSSGGNNYDIALLELECELTFNDNVQPVQLPEQDDP----IDEGTMGI 167

  Fly   159 ISGWGNIAEKGPLSDSLLFVQVTSISRGACR--WMFYSRLPETMICLLHSK-NSGACYGDSGGPA 220
            :||||.......|:..|....|.::::..|.  :..|..:.|.|.|..:.: .:|.|..|||||.
Mosquito   168 VSGWGMTMSAADLNAILRATNVPTVNQQECNQAYQSYGGVAEQMFCAGYKQGGTGTCRNDSGGPF 232

  Fly   221 TYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEKAGL 262
            ...||::|:.|  ....|..|. |..|.|::.||.||.|.:|:
Mosquito   233 VAEGKLIGVVS--WSHECALAGYPGVYARVASVRDWIRETSGV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/230 (32%)
Tryp_SPc 37..219 CDD:238113 59/191 (31%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 73/230 (32%)
Tryp_SPc 47..270 CDD:238113 74/232 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.