DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:287 Identity:89/287 - (31%)
Similarity:136/287 - (47%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WTTLWTVLLLLLCGVQVILGQDVAQNQSE---SAIEP--------------RIVGGIKAKQGQFP 49
            :|||..||..||.         .|:.|:|   ....|              |||||........|
Mosquito     5 FTTLLAVLFALLA---------YARAQAERRHKLTRPVHRFAPNRPYLAGKRIVGGFVINISDAP 60

  Fly    50 HQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIM 114
            :||||:...:|.|||.|:|:..::||.||:   ||..|:.. :::.||...:|.|..|.||.::.
Mosquito    61 YQISLQYDDDHNCGGSILSSKWILTAAHCI---NDNAPSKP-TVRVGSSKHASGGTVIRVARIVP 121

  Fly   115 HPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPP---NCVAVDISGWGNIAEKGPLSDSLL 176
            ||.:.:..:.|:|:|.|::.|||...:..|.|..:|.|   ..:.: :||||....:...:|.|.
Mosquito   122 HPMHGSKNNYDIALLELKNELTFSEKVQPIALPEQDEPIEEGTMGI-VSGWGLTLSEADSNDVLR 185

  Fly   177 FVQVTSISRGACRWMFYSR---LPETMICLLHSKNSG--ACYGDSGGPATYGGKVVGLASLLLGG 236
            ...|.::::..|...:.||   :.:.|.|..: |..|  .|..|||||....||::|:.|  .|.
Mosquito   186 ATNVPTVNQQECNKAYQSRYGGITDQMFCAGY-KQGGQDTCRQDSGGPFVAKGKLIGVIS--WGH 247

  Fly   237 GCGRAA-PDGYLRISKVRAWIAEKAGL 262
            .|..|. |..|.|::.||.||...:|:
Mosquito   248 ECALAGYPGVYARVASVRDWIRTTSGV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/228 (33%)
Tryp_SPc 37..219 CDD:238113 60/189 (32%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 75/228 (33%)
Tryp_SPc 48..271 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.