DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:281 Identity:85/281 - (30%)
Similarity:132/281 - (46%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQVILGQDVAQNQ--------------SESAIEPRIVGGIKAKQGQFPHQISLRLR 57
            |:||.:|..| |...|..|.:|              ..:....|||||.:....:.|:|:||:..
Mosquito     6 TILLAVLLAV-VACAQAHASHQRRVPYPLPRFLPRPHHTVSNHRIVGGFEIDVAETPYQVSLQRS 69

  Fly    58 GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG 122
            ..|.|||.::|...::||.||.....   ||.| :::.||...:|.|..|.||.::.||:|....
Mosquito    70 KRHICGGSVLSGKWILTAAHCTDGSQ---PASL-TVRLGSSRHASGGSVIHVARIVQHPDYDQET 130

  Fly   123 HN-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD------ISGWGNIAEKGPLSDSLLFVQV 180
            .: |.::|.|:|.|||...:..|.|..:|.    ||:      :||||:.......:..|....|
Mosquito   131 IDYDYSLLELESVLTFSNKVQPIALPEQDE----AVEDGIMTIVSGWGSTKSAIESNAILRAANV 191

  Fly   181 TSISRGACRWMFYSR--LPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA 242
            .::::..|...::..  :.|.|:|..:.: ...||.||||||.....|::|:.|  .|.||.:..
Mosquito   192 PTVNQDECNQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVS--WGAGCAQPG 254

  Fly   243 -PDGYLRISKVRAWIAEKAGL 262
             |..|.|::.||.||.|..|:
Mosquito   255 YPGVYARVAVVRDWIRETCGV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/230 (31%)
Tryp_SPc 37..219 CDD:238113 58/191 (30%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 72/230 (31%)
Tryp_SPc 49..272 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.