DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008403

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317049.4 Gene:AgaP_AGAP008403 / 1277577 VectorBaseID:AGAP008403 Length:873 Species:Anopheles gambiae


Alignment Length:246 Identity:62/246 - (25%)
Similarity:108/246 - (43%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QFPHQISLRLRGEH-----YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSD--- 103
            :|.|..::...||:     .|||.:|...:|:||.||....|:..| |:  ::.|.:.|..|   
Mosquito    27 EFAHMAAVGWTGENGKIDWNCGGSLIWENYVLTAAHCTADDNNAAP-DV--VRLGDINLDDDSDD 88

  Fly   104 --GVRIPVAEVIMHPNYA-TGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCV---------A 156
              ..::.:.|:|.||.:. :..::|||:|||:..:|....:|         |.|:         :
Mosquito    89 KYAQQLKIVEIIRHPEHRFSSRYHDLALLRLERNVTLHDTVA---------PGCLWNDEEIPFPS 144

  Fly   157 VDISGWGNIA-EKGPLSDSLLFVQVTSISRGACRWMF-------YSRLPETMICLLHSKNSGACY 213
            ::.:|||:.. .|.|:   ||.|.::.:.:..|...:       ...|.:..:|....| ...|.
Mosquito   145 MEATGWGSTGFAKTPI---LLKVSLSLVPKSTCDQQYRKGDRGLRQGLQDYQLCAGDIK-MDTCP 205

  Fly   214 GDSGGP--------ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ||||||        |.....::.:.|  .|..||::.|..|:::|....||
Mosquito   206 GDSGGPLQMKLLANAKMTPFIIAVTS--FGSVCGQSTPGVYMKVSPYIPWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/244 (25%)
Tryp_SPc 37..219 CDD:238113 50/199 (25%)
AgaP_AGAP008403XP_317049.4 Tryp_SPc 20..256 CDD:238113 62/246 (25%)
Tryp_SPc 20..254 CDD:214473 60/244 (25%)
Tryp_SPc 324..552 CDD:304450
CLIP 577..617 CDD:295450
Tryp_SPc 656..872 CDD:304450
Tryp_SPc 656..869 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.