DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006487

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_316522.4 Gene:AgaP_AGAP006487 / 1277089 VectorBaseID:AGAP006487 Length:281 Species:Anopheles gambiae


Alignment Length:285 Identity:80/285 - (28%)
Similarity:118/285 - (41%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHY----CGGVIISATHV 72
            |:.....:||...|....|:.  ||:.||.....||:|..:.:.   ..|    |.|.:::..||
Mosquito     6 LVLAFLALLGSTQALPSDEAG--PRVTGGTATLLGQYPSAVIIE---TPYIPQNCMGTVVNRQHV 65

  Fly    73 ITAGHCVKHGNDVVPAD-LW-SIQAGSLLLSSDGVRIPVAEVI---MHPNY--ATGGHNDLAVLR 130
            :||..||.:....|..: .| .:.||.:.:.....|..|.:||   :||||  .|.| |:|||||
Mosquito    66 LTAASCVMNPTTFVMINPFWLRVIAGDINIVPVSTRREVRQVIRSYVHPNYNRLTDG-NNLAVLR 129

  Fly   131 LQ----------SPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISR 185
            :.          .|...:|.|.|      |...||   .:|||....           |||::.|
Mosquito   130 VDVPFPEFHNTIEPALLNARILA------DNTQCV---FAGWGATQN-----------QVTAVVR 174

  Fly   186 G-------------ACRW--MFYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASL 232
            .             :|..  :..:|:.:||||   |..|:|: .|.|:.||.....|::.|:  |
Mosquito   175 PNQFVVTQPILATVSCNAANVHNNRVQQTMICAGALAQSQNA-VCRGNMGGGLYCNGRLTGV--L 236

  Fly   233 LLGGGCGRA-APDGYLRISKVRAWI 256
            ..|.|||.| .|..|:.:.:...||
Mosquito   237 AFGLGCGVANQPGVYMDVRQYTQWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/259 (28%)
Tryp_SPc 37..219 CDD:238113 60/220 (27%)
AgaP_AGAP006487XP_316522.4 Tryp_SPc 28..261 CDD:214473 72/259 (28%)
Tryp_SPc 29..264 CDD:238113 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.