DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:267 Identity:75/267 - (28%)
Similarity:122/267 - (45%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVI-LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL---RGEH-YCGGVIISATHVI 73
            |.:.:: |...|||......:  |:|.|..||.||||:|:.|.|   .|:. .|||.:::...|:
Mosquito     6 CALALLALVASVAQAAPRGGM--RVVNGETAKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWVL 68

  Fly    74 TAGHCVKHGNDVVPADLWSIQAGSLLLS---SDG-VRIPVAEVIMHPNY-----ATGGHNDLAVL 129
            ||||||.....|      .:..|::..|   :|| :.:...|...|..|     |    ||:|::
Mosquito    69 TAGHCVMLAKSV------EVHLGAVDFSDNTNDGRLVLESTEFFKHEKYNPLFVA----NDVALV 123

  Fly   130 RLQSPLTFDANIAAIQLATEDPPNC-VAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY 193
            :|.|.:.|...:..::|.|.|.... ..|.:||||.:...|.::..|.:..:..|....|:..|.
Mosquito   124 KLPSKVEFSERVQPVRLPTGDEDFAGREVVVSGWGLMVNGGQVAQELQYATLKVIPNKQCQKTFS 188

  Fly   194 SRL-PETMICLLHSKNSGACYGDSGGPATYG--GKVVGLASLLLGGGCGRAAPDGYLRISKVRAW 255
            ..| .::.:|.:..:....|.||||||....  ..:||:.|.....||.:..|..:.|::..|.|
Mosquito   189 PLLVRKSTLCAVGEELRSPCNGDSGGPLVLAEDKTLVGVVSFGHAQGCDKGHPAAFARVTAFRDW 253

  Fly   256 IAEKAGL 262
            :.:..|:
Mosquito   254 VKKHTGV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/236 (29%)
Tryp_SPc 37..219 CDD:238113 57/196 (29%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 68/236 (29%)
Tryp_SPc 28..257 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.