DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006087

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_316143.4 Gene:AgaP_AGAP006087 / 1276758 VectorBaseID:AGAP006087 Length:342 Species:Anopheles gambiae


Alignment Length:271 Identity:85/271 - (31%)
Similarity:114/271 - (42%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQNQSESAIEP-----RIVGGIKAKQGQFPHQISLR-LRGEH--------YCGGVIISATHVITA 75
            |....|..::|     |||||..|..|..|..:||| |..|.        :|||.:|:|:.|:||
Mosquito    46 AYRSVECDVDPSDLGERIVGGRNALYGDAPFHVSLRSLYHERRHGFGSGLFCGGSLITASRVLTA 110

  Fly    76 GHC--VKHGNDVVPADLWSIQAGSLLLSSDGVRIP---VAEVIMHPNYATGGH-----NDLAVLR 130
            .||  .|..|.||       .||.|.......|:.   |...:.||    |.|     .|:.::.
Mosquito   111 SHCFTTKPSNMVV-------VAGVLNRFDRSKRMQQRRVLRYLSHP----GWHARTLAADIGLVA 164

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKG------PLSDSLLFVQVTSISRGACR 189
            |.||......:..|.||...|.:.....|.|||. .|:|      |:......|.|..:.|  |.
Mosquito   165 LVSPFQCGGGVQPIALANRPPVDGEPCTIYGWGQ-TEEGRKQRFQPVCLQKASVSVLGLER--CN 226

  Fly   190 WMFYS--RLPETMICLLHSKNSG--ACYGDSGGPATY--GGKVVGLASLLLGGGCGRA-APDGYL 247
            ...::  .:|:..:| ..|.:.|  :|.||||||...  ||.:.|:.|  .|.||||| .|..|.
Mosquito   227 RSLHTVVTVPDGTLC-AGSFDGGVDSCQGDSGGPLVCGGGGALYGIVS--FGWGCGRANFPGVYT 288

  Fly   248 RISKVRAWIAE 258
            .:.:.|.||.|
Mosquito   289 DVFQYRGWIVE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/251 (31%)
Tryp_SPc 37..219 CDD:238113 63/210 (30%)
AgaP_AGAP006087XP_316143.4 Tryp_SPc 62..297 CDD:214473 79/251 (31%)
Tryp_SPc 63..297 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.