DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005691

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315702.4 Gene:AgaP_AGAP005691 / 1276364 VectorBaseID:AGAP005691 Length:301 Species:Anopheles gambiae


Alignment Length:251 Identity:73/251 - (29%)
Similarity:108/251 - (43%) Gaps:44/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEH-----YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQA 95
            ||..|.:|..|||||||:  |..|:     .|||.|::...::||.|||..|    |:.|.|  .
Mosquito    55 RITNGQEATPGQFPHQIA--LLSEYATSTGLCGGSILTRNTILTAAHCVVSG----PSTLAS--G 111

  Fly    96 GSLLLSSDG----------VRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATE 149
            |..::.:..          :|...:.:.:||.|.... .||:|.:||.||:||...|..|:|...
Mosquito   112 GVAIMGAHNRNVQESTQQRIRFATSGIRVHPQYNLASIRNDIATVRLNSPMTFTTRIQPIRLPGR 176

  Fly   150 DPP---NCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGA---CRWMFYSRLPETM-----ICL 203
            ...   ......:||:|..::....:.:::......:...|   .||      ..||     :||
Mosquito   177 SDTRQFGGFTGTVSGFGRTSDASTATSAVVRFTTNPVMTNADCVARW------GTTMVQNQNVCL 235

  Fly   204 LHSKNSGACYGDSGGPATY--GGKV-VGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ..:....||.|||||..|.  ||.: :|:.|.:...||....|..|.|:|....||
Mosquito   236 SGAGGRSACNGDSGGALTVQSGGTLQIGVVSFVSVNGCAVGMPSVYARVSFFLPWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/249 (29%)
Tryp_SPc 37..219 CDD:238113 58/208 (28%)
AgaP_AGAP005691XP_315702.4 Tryp_SPc 55..291 CDD:214473 71/249 (29%)
Tryp_SPc 56..294 CDD:238113 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.