DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005671

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315688.1 Gene:AgaP_AGAP005671 / 1276351 VectorBaseID:AGAP005671 Length:300 Species:Anopheles gambiae


Alignment Length:244 Identity:70/244 - (28%)
Similarity:110/244 - (45%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLR---LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            ||..|.:|..||||:||:|.   ..|...|||.:::.|.::||.|||..|...:      .:.|:
Mosquito    54 RITNGQEATPGQFPYQIALLSEFATGTGLCGGSVLTNTFILTAAHCVVSGATTL------ARGGT 112

  Fly    98 LLL----------SSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQL-ATED 150
            .::          |...:|.....:|.||.|:|.. .||:||:||...:.|:..:...:| |..|
Mosquito   113 AIMGAHNRNVNEPSQQRIRFSTGGIIRHPQYSTTNIRNDIAVVRLDGTIVFNTRVQPARLPARSD 177

  Fly   151 PPNC--VAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGAC--RWMFYSRLPETMICLLHSKNSG 210
            ....  ....:||:|..::....:.::: |.:...::...|  ||......|:. :||.......
Mosquito   178 TRQFGGFTGTVSGFGRTSDGSSATSAVVRFTRNPVMTNADCIARWNTALIQPQN-VCLSGEGGRS 241

  Fly   211 ACYGDSGGPATY--GGKV-VGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            :|.||||||.|.  ||.: :|:.|.....||....|..|.|:|....||
Mosquito   242 SCNGDSGGPLTVQDGGSLQIGIVSFGSAAGCSIGMPSVYARVSFFLPWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/242 (28%)
Tryp_SPc 37..219 CDD:238113 54/201 (27%)
AgaP_AGAP005671XP_315688.1 Tryp_SPc 54..290 CDD:214473 68/242 (28%)
Tryp_SPc 55..293 CDD:238113 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.