DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and SCRASP1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315638.3 Gene:SCRASP1 / 1276311 VectorBaseID:AGAP005625 Length:1322 Species:Anopheles gambiae


Alignment Length:251 Identity:75/251 - (29%)
Similarity:112/251 - (44%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |:|.|.:...|..|.|.|||::..|:||.|:|:..||:||.||:..    .|...:.::.|....
Mosquito  1078 RVVHGSETVYGHHPWQASLRVKTMHWCGAVLITRYHVLTAAHCLIG----YPKSTYRVRIGDYHT 1138

  Fly   101 SS-DGVRIP--VAEVIMHPNYATGGH--NDLAVLRLQSPLTFDANIAAIQLATEDPP-----NCV 155
            :: |...:.  :....:|..:..|.|  ||:||:.|::|:.|:..:..|.|...|.|     ||.
Mosquito  1139 AAYDNAELDIFIENTYIHEQFREGHHMSNDIAVVVLKTPVRFNDYVQPICLPARDAPYLPGQNCT 1203

  Fly   156 AVDISGWGNIAEKGPLSDS--LLFVQVTSISRGACR--WMFYSRLPETMICLLHSKNSG------ 210
               ||||| ..|.|....|  |....|..:....||  .::...|.:.|.|      :|      
Mosquito  1204 ---ISGWG-ATEAGSKDSSYDLRAGTVPLLPDSVCRRPEVYGDSLIDGMFC------AGTLEPGV 1258

  Fly   211 -ACYGDSGGPATYGGK-----VVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEK 259
             :|.||||||......     :.|:.|  .|..||.| .|..||:::..|.||.:|
Mosquito  1259 DSCDGDSGGPLVCPNSEGLHTLTGIVS--WGKHCGYANKPGVYLKVAHYRDWIEQK 1312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/246 (29%)
Tryp_SPc 37..219 CDD:238113 59/202 (29%)
SCRASP1XP_315638.3 ChtBD2 181..228 CDD:214696
ChtBD2 289..334 CDD:214696
LDLa 731..762 CDD:238060
SRCR 776..878 CDD:278931
SR 776..877 CDD:214555
LDLa 884..921 CDD:238060
SR 927..1025 CDD:214555
SRCR 932..1025 CDD:278931
Tryp_SPc 1078..1309 CDD:214473 72/246 (29%)
Tryp_SPc 1079..1312 CDD:238113 73/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.