DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008808

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_557970.3 Gene:AgaP_AGAP008808 / 1275666 VectorBaseID:AGAP008808 Length:574 Species:Anopheles gambiae


Alignment Length:280 Identity:82/280 - (29%)
Similarity:121/280 - (43%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPR-------IVGGIKAKQGQFP-HQISLRLRG---EHYCG 63
            :|||.|....:.:...|.::......|       |..|:.||.|.:| |.......|   |:.||
Mosquito    10 VLLLFGFLYFMSRACGQEENYLTCGRRKVQSVFLIHNGVDAKAGHWPWHAAIFHGNGRQEEYQCG 74

  Fly    64 GVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL--SSDGVRI-PVAEVIMHPNYATGG-HN 124
            |.|:....::||.|||.....|:.|...|:..|.:.|  :|:..:| .|.::|:||.:.:.. :|
Mosquito    75 GSILDQNTILTASHCVYTHKSVISAARVSVHVGQIHLKETSEYTQIHGVQDIILHPEFNSNSFNN 139

  Fly   125 DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAV----DISGWGNIAEKGPLSDSLLFVQVTSISR 185
            |:|:|:|.:.:|....:..:.|.|.|....:.|    .|.|:| :.|...:||.|....|..:..
Mosquito   140 DIALLKLSTNITMTKYVQPVCLWTMDSNQEMIVGKNGTIVGFG-LNEHDVVSDQLKQALVGVVDA 203

  Fly   186 GAC----RWMFYSRLPETMICLLHSKNSGACYGDSGGPATY--GGK--VVGLASLL-LGGGCGRA 241
            ..|    |..|...|...|.|.......|||.|||||...:  |||  |.||.|.. |.|..|..
Mosquito   204 LTCIKSDRAAFGPVLTSEMFCGKGRTGVGACNGDSGGGMFFEVGGKWFVRGLVSFTPLRGNTGLC 268

  Fly   242 AP---DGYLRISKVRAWIAE 258
            .|   ..|..::|...||.:
Mosquito   269 DPLKYTAYTDVAKYLEWIKQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/250 (30%)
Tryp_SPc 37..219 CDD:238113 60/197 (30%)
AgaP_AGAP008808XP_557970.3 Tryp_SPc 44..288 CDD:238113 76/244 (31%)
Tryp_SPc 46..286 CDD:214473 73/240 (30%)
Tryp_SPc 324..566 CDD:304450
Tryp_SPc 330..566 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.