DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP008558

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314667.4 Gene:AgaP_AGAP008558 / 1275424 VectorBaseID:AGAP008558 Length:574 Species:Anopheles gambiae


Alignment Length:241 Identity:64/241 - (26%)
Similarity:102/241 - (42%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGE----HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            |:||..|..||:|...::..|.|    :.|||.||:...::||.|||:....|:..|..|:|.|.
Mosquito    37 ILGGEDAISGQWPWHAAIFHRIERSFMYQCGGAIINQNTILTAAHCVQLNQGVITVDRLSVQVGR 101

  Fly    98 LLL---SSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQL---ATEDPPNCV 155
            ..|   .|.........:|:|..| |....||:|:::|.:.:.|...:..:.|   |..|....:
Mosquito   102 TYLYAAESHTQEHQAERIIVHEEYSAAQVRNDIALIKLATDIRFTEYVQPVCLWDRARTDIGQLI 166

  Fly   156 --AVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC----RWMFYSRLPETMICLLHSKNSGACYG 214
              ...:.|:| |.|.|.::|.|....:..:....|    |.:|...|...:.|......:..|.|
Mosquito   167 GRVGTVIGFG-ITEIGEVADRLRVAYMPIVDTQTCLESNRNLFGRVLTRNVFCAGFRNGTTVCGG 230

  Fly   215 DSGGPATYGGK----VVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ||||...:..:    :.|:.| ..|..|..|...|:..::....||
Mosquito   231 DSGGGMYFEIENRWYIRGIVS-FSGQNCQSADFAGFSDVATYLDWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/239 (26%)
Tryp_SPc 37..219 CDD:238113 55/198 (28%)
AgaP_AGAP008558XP_314667.4 Tryp_SPc 37..277 CDD:238113 64/241 (27%)
Tryp_SPc 37..275 CDD:214473 62/239 (26%)
Tryp_SPc 322..568 CDD:214473
Tryp_SPc 322..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.