DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CLIPE5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314516.3 Gene:CLIPE5 / 1275278 VectorBaseID:AGAP010547 Length:373 Species:Anopheles gambiae


Alignment Length:183 Identity:45/183 - (24%)
Similarity:72/183 - (39%) Gaps:51/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLC-GVQVIL--GQDVAQNQSESAIE-----PRIVGGIKAKQGQFPHQISLRLRGEHY------ 61
            :::| |..|:.  ..||..|.||...|     .|.|...|.:|.|:.....||||..|:      
Mosquito   104 IIICSGGSVVCCPRTDVTSNPSEIEREFNECGQRYVQLRKQRQQQWEGFQPLRLRLPHFAEVGWE 168

  Fly    62 --------CGGVIISATHVITAGHC-VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPN 117
                    |...:||.:.|:|:..| |....:.....|.:|::|.  .:::...||::.|.:||.
Mosquito   169 EGSEIRFQCIAYLISTSAVVTSASCLVSKEFEPTVVRLGNIRSGP--QTTNIAIIPISTVEIHPE 231

  Fly   118 YATGGHNDLAVLRLQSPLTFDANIAAIQLATE-DP-----PNCVAVDISGWGN 164
            :              :..||:.|||.::|... .|     |.|:      |.|
Mosquito   232 F--------------NQSTFENNIALLKLTLPVQPTVYMFPGCL------WQN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 36/150 (24%)
Tryp_SPc 37..219 CDD:238113 35/149 (23%)
CLIPE5XP_314516.3 Tryp_SPc 174..>261 CDD:304450 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.