DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010545

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314514.4 Gene:AgaP_AGAP010545 / 1275276 VectorBaseID:AGAP010545 Length:876 Species:Anopheles gambiae


Alignment Length:226 Identity:64/226 - (28%)
Similarity:104/226 - (46%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSD-----GVRIPVAEVIMHPNYA-T 120
            |||.:|....:|||.||..:.::|.| |:  ::.|.|.:.||     ..::.:..:|.||.|: :
Mosquito    47 CGGSLIWNNFIITAAHCTANDDNVSP-DV--VRFGDLNIYSDEDDRYAQQLTIVSIIRHPKYSFS 108

  Fly   121 GGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISR 185
            ..:.|:|:::|.:.::....:|...|..:.......::.:|||........:..||.:.:..:|.
Mosquito   109 ARYYDIALMKLDNNVSVHETVAPACLWLDKEVRFKELESAGWGQTGFGESPTPILLKITLKPMSN 173

  Fly   186 GACRWMFYSR--------LPETMICLLHSKNSGACYGDSGGP----ATYGGKV----VGLASLLL 234
            ..|...:.|.        |.:..||...:| ...|.||||||    ..:..||    |||.|  .
Mosquito   174 ENCTEHYTSTTVRGLQRGLDQHHICAGDAK-MDTCLGDSGGPLHIRLQHNYKVTPFLVGLTS--F 235

  Fly   235 GGGCGRAAPDGYLRISKVRAWIAE---KAGL 262
            |..||::.|..|.||:..|:||.|   |.||
Mosquito   236 GRPCGQSHPGVYTRIAPFRSWIVETLQKNGL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/215 (27%)
Tryp_SPc 37..219 CDD:238113 42/170 (25%)
AgaP_AGAP010545XP_314514.4 Trypsin 21..257 CDD:278516 58/215 (27%)
Tryp_SPc 47..260 CDD:238113 60/218 (28%)
Tryp_SPc 336..544 CDD:304450
Tryp_SPc 677..867 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.