DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:238 Identity:62/238 - (26%)
Similarity:102/238 - (42%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP---------VAEVIMHPN 117
            |||.:|:..||:||.||..:.:.|.|.   .::.|.:.::: |:..|         ::....||.
Mosquito    17 CGGSLITPRHVLTAAHCALNDDGVAPQ---VVRLGVIDITA-GLYDPQNQFAQEYGISSFRRHPE 77

  Fly   118 YA-TGGHNDLAVLRLQSPLTF-DANIAAIQLATEDPPNCV---------AVDISGWGNIAEKGPL 171
            :. ...::|:.::.|..|:|. ||.:          |.|:         .::..|:|..:..|..
Mosquito    78 HEFRAEYHDIGLVTLDRPVTLTDAVV----------PACLWTGAQVPLRRLEAVGFGQTSFGGER 132

  Fly   172 SDSLLFVQVTSISRGACRWMFY--SR-----LPETMICLLHSKNSGACYGDSGGPATYGGK---- 225
            :..||.||::.:...|| ..||  ||     |.:..:| ...:....|:||||||...  |    
Mosquito   133 TPILLKVQLSPVDNSAC-GRFYPPSRRRRQGLIDQQMC-ASDERMDTCHGDSGGPLQL--KLMAN 193

  Fly   226 ------VVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262
                  |||:.|  .|..||.|.|..|.|:|....|:..:.|:
Mosquito   194 NRLIPFVVGITS--FGRFCGTATPAVYTRVSSYVDWLQTETGV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/230 (26%)
Tryp_SPc 37..219 CDD:238113 45/183 (25%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 61/231 (26%)
Tryp_SPc 1..227 CDD:214473 60/229 (26%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.