DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004859

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314332.2 Gene:AgaP_AGAP004859 / 1275102 VectorBaseID:AGAP004859 Length:264 Species:Anopheles gambiae


Alignment Length:244 Identity:60/244 - (24%)
Similarity:94/244 - (38%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VGGIKAKQGQFPHQI---SLRLRG--EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            |.||.::..|..|.:   |.|..|  |..|||..|....|:...|||...|.  || |.:::.||
Mosquito    20 VQGIFSQNPQTSHIVLLGSTRSDGTREFRCGGSYIGQNIVLAGAHCVTGKNQ--PA-LDTVRFGS 81

  Fly    98 LLLSSDGV-RIPVAEVIMHPNYATG-GHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDIS 160
               .:|.| ...:....:|..|... .::::||..|      ||....:. |....|.|:.....
Mosquito    82 ---GTDNVMHFRIVNHTLHYRYKPQFEYHNMAVYYL------DARPDLVN-AGRFKPACILKPHM 136

  Fly   161 GWGNIAEKGPLSDSL-LFVQVTS---ISRGACRWMFYSRLPE----TMICLLHSKNSGA--CYGD 215
            ..|.:...|..|:.. |.:|.||   ::...|. .:|:.:|:    .::|...:.||..  |...
Mosquito   137 KQGIVQMVGDSSNGRGLALQSTSLDVVASEKCH-EYYNPIPKLRFGVLLCCFCAMNSDTTECSNM 200

  Fly   216 SGGP----ATYGGK----VVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ...|    ....||    ::|..|  :|..||..:|..:.|......|:
Mosquito   201 HSSPLQLVINRNGKSVPFLIGHKS--IGKACGVKSPAVFTRYGSYYEWL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/242 (24%)
Tryp_SPc 37..219 CDD:238113 49/197 (25%)
AgaP_AGAP004859XP_314332.2 Trypsin 41..247 CDD:278516 52/221 (24%)
Tryp_SPc 43..250 CDD:304450 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.