DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:251 Identity:73/251 - (29%)
Similarity:118/251 - (47%) Gaps:15/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGV--QVILGQDVAQNQSESAIEP--RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :.|.|:  .|:|   |..:...|.:||  .|:||...:..:.|:.:|:.: ....|||.||:...
Mosquito     1 MFLSGIVPLVLL---VVHSLEASPVEPLAPIIGGSNVEDKKVPYLVSITV-NSFVCGGSIIADRW 61

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPL 135
            ::||.||||. |.|..|   :::..:...::.|....:...|.|..|..|. .:|:.:|||:|||
Mosquito    62 ILTAAHCVKR-NMVKNA---AVRVETNNFTASGTLYRIDRAIAHEKYFRGAFRDDVGLLRLRSPL 122

  Fly   136 TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETM 200
            .|...:..|:|.::..|....:.:.|.|.|::....:.....::..:|:...||.|....:....
Mosquito   123 KFGERVKKIELLSQIVPYNATLTLVGRGYISKDNKTTKITQMIKAKNIALKLCRKMQPDFIYPGH 187

  Fly   201 ICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            :|....|..|.|.||||||..:.|:.||:.|  ...|||....|.:.|||....||
Mosquito   188 LCTFVKKGKGTCSGDSGGPVVWYGRQVGIVS--WSKGCGAGYFDVHSRISYFLPWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/220 (29%)
Tryp_SPc 37..219 CDD:238113 50/182 (27%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 65/221 (29%)
Tryp_SPc 28..241 CDD:214473 63/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.