DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005194

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314093.2 Gene:AgaP_AGAP005194 / 1274900 VectorBaseID:AGAP005194 Length:272 Species:Anopheles gambiae


Alignment Length:239 Identity:70/239 - (29%)
Similarity:111/239 - (46%) Gaps:24/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV-------KHGNDVVPADLWSIQ 94
            ||.|..|::...|:|:||::.|...|.|.|:....::||.|||       :..|:.      .:.
Mosquito    34 IVDGSDAEENAAPYQVSLQIDGNSTCSGSIVGDRWILTAEHCVPLLQFFSERSNNT------RVV 92

  Fly    95 AGSLLLSSDGVRIPVAEVIMHPNYAT---------GGHNDLAVLRLQSPLTFDANIAAIQLATED 150
            ||:..|...|....:.....:.|.:|         ...||:|::||.:||.|:..:..|:..||.
Mosquito    93 AGTNDLKKGGTPYFIDRFFNYDNCSTMLVHTFMFNSTPNDIALIRLTTPLKFNQRVKKIEFTTET 157

  Fly   151 PPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF-YSRLPETMICLLHSKNSGACYG 214
            .|....:.::|||.: ..|.....|..:...||....||.:: .:.|.:..||.|..:..|||.|
Mosquito   158 VPENATLTLTGWGQM-RNGTSPAKLQTINAPSIRIDHCRAIYNETYLNDGTICSLSKRGEGACMG 221

  Fly   215 DSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            |||||.|:.||:||:...:...|||...||.:..::....||.:
Mosquito   222 DSGGPVTWKGKLVGIFKAVHNKGCGEGFPDIHTSVAYYYKWIKD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/235 (29%)
Tryp_SPc 37..219 CDD:238113 56/198 (28%)
AgaP_AGAP005194XP_314093.2 Tryp_SPc 34..266 CDD:238113 70/239 (29%)
Tryp_SPc 34..263 CDD:214473 68/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.