DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:223 Identity:83/223 - (37%)
Similarity:122/223 - (54%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |||||..|:..|.|:||:|..:|...|||.||...||:||.|||...:.::||..:.:.|||..|
Mosquito    28 RIVGGQLAEDTQMPYQIALFYQGSFRCGGSIIGDRHVLTAAHCVMDDDVLLPAFKFGVHAGSAHL 92

  Fly   101 SSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNI 165
            ::.|....|..|..|..|....| |:||:.::.|..||..|..|:|..|:.|....|.|||:|.:
Mosquito    93 NAGGKLFKVRAVYPHEGYGNFQH-DIAVMEMKEPFAFDKYIQPIELMDEEVPLGGEVVISGYGRV 156

  Fly   166 AEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLA 230
            ...||:|.:||:..:..:....|     :.:.|.::|:....:.|||.|||||||.|.||:.|:|
Mosquito   157 GSNGPVSPALLYTSMFVVEDENC-----NSISEGLMCIDKEGSYGACNGDSGGPAVYDGKLAGVA 216

  Fly   231 SLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            :.:: ..||....|||.::|....||.:
Mosquito   217 NFII-DQCGGNFADGYAKVSFYLDWIRQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/219 (37%)
Tryp_SPc 37..219 CDD:238113 66/181 (36%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 81/219 (37%)
Tryp_SPc 29..243 CDD:238113 82/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.