DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004568

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313873.5 Gene:AgaP_AGAP004568 / 1274710 VectorBaseID:AGAP004568 Length:283 Species:Anopheles gambiae


Alignment Length:242 Identity:65/242 - (26%)
Similarity:108/242 - (44%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQA 95
            :|...:||||.:|:.|::|..::|.......|||.:|:..:|:||.||| .|:|.....:..:..
Mosquito    37 NANNSKIVGGHEAEIGRYPWMVALYYNNRFICGGSLINDRYVLTAAHCV-FGSDRSRFSVKFLMH 100

  Fly    96 GSLLLSSDGVRIPVAEVIMH--PNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPP--NCVA 156
            ...:...|.....|:.::.:  .|......||:|:|:|..|:.....|..:.|    ||  |..|
Mosquito   101 DRTVPKEDSFERKVSYIMTNWFLNVLVFITNDVALLKLSEPVPLGETIIPVCL----PPEGNTYA 161

  Fly   157 VD---ISGWGNIAEKGPLSDSLLFVQVTSISRGACR---WMFYSRLPETMICL-LHSKNSGACYG 214
            ..   ::|||.:.: |.....|..|.|..:|...|.   ..|..::.:.|:|. :......:|.|
Mosquito   162 GQEGIVTGWGKLGD-GTFPMKLQEVHVPILSNEQCHNQTQYFRFQINDRMMCAGIPEGGKDSCQG 225

  Fly   215 DSGGPA----TYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            |||||.    |...:.|....:..|.||.:.. |..|.|:::..:||
Mosquito   226 DSGGPMHVFDTEANRFVIAGVVSWGFGCAQPRFPGIYARVNRFISWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/235 (26%)
Tryp_SPc 37..219 CDD:238113 52/192 (27%)
AgaP_AGAP004568XP_313873.5 Tryp_SPc 42..272 CDD:214473 62/235 (26%)
Tryp_SPc 43..275 CDD:238113 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.