DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:260 Identity:78/260 - (30%)
Similarity:121/260 - (46%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75
            :|...:.:...:..|.||     |.|||||......|:|....|...|:.:||..:::..:|:||
Mosquito     1 MLTANLLIFFSECGAANQ-----EIRIVGGRPTGVNQYPWLARLVYDGQFHCGASLLTKDYVLTA 60

  Fly    76 GHCV----KHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPL 135
            .|||    ::...|:..|.....|.    .:..:...|..:|.|.::....:| |:|:|:|:.|:
Mosquito    61 AHCVRRLKRNKIRVILGDYDQFVAS----ETPAIMRAVTAIIRHRSFDQNSYNHDIALLKLRKPV 121

  Fly   136 TFDANIAAIQLATE--DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY--SRL 196
            .|...|..:.|..|  :|...:.. :.|||..:|.|.|...:..|.|..::...||.|.|  ||:
Mosquito   122 EFTKTIRPVCLPKERSEPAGQLGT-VVGWGRTSEGGTLPALVQHVDVPILTLDQCRSMKYRASRI 185

  Fly   197 PETMICLLHSKNSGACYGDSGGP--ATYGGK--VVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            ...|:|....|.. :|.||||||  ...|.|  :||:.|  .|.|||||. |..|.|:::...|:
Mosquito   186 TSNMLCAGKGKQD-SCQGDSGGPLLVRNGDKHEIVGIVS--WGVGCGRAGYPGVYTRVARYLPWL 247

  Fly   257  256
            Mosquito   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/233 (31%)
Tryp_SPc 37..219 CDD:238113 55/190 (29%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 72/232 (31%)
Tryp_SPc 22..250 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.