DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:249 Identity:73/249 - (29%)
Similarity:112/249 - (44%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AIEP---RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSI 93
            ::||   ||||||..:...|....:|....:..|||.::|..:||||.||....:    ..|:.:
Mosquito   103 SVEPINERIVGGIPVEDNSFSWMAALYYDNKFCCGGSLLSDRYVITAAHCTTKPD----RGLFRV 163

  Fly    94 QAGSLLLS---SDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQL--ATEDPPN 153
            |.|....|   :..:...|..::.:...|...:||:|:|.|..|:.....:..|.|  |||....
Mosquito   164 QFGINDRSKPIATSIERSVKRILTNWYNAFNNNNDIALLELTYPVAISDRVMPICLPQATEMYEG 228

  Fly   154 CVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACR----WMFYSRLPETMIC---LLHSKNSGA 211
            ...: ::|||.....|.||.:|:..:|..::...||    |.|  ::...|:|   |...|:|  
Mosquito   229 SRGI-VTGWGRTKAGGGLSGTLMQTEVPILTNRECRRAGYWAF--QITNKMLCAGYLEGGKDS-- 288

  Fly   212 CYGDSGGPAT--------YGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |.||||||..        |  ::||:.|  .|..|. :..|..|.|:|:...||
Mosquito   289 CQGDSGGPLQVLNTKSNHY--ELVGVVS--WGRACAQKNFPGVYARVSQYLYWI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/240 (29%)
Tryp_SPc 37..219 CDD:238113 56/193 (29%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 69/240 (29%)
Tryp_SPc 111..341 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.