DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004149

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313033.3 Gene:AgaP_AGAP004149 / 1273976 VectorBaseID:AGAP004149 Length:543 Species:Anopheles gambiae


Alignment Length:307 Identity:76/307 - (24%)
Similarity:116/307 - (37%) Gaps:105/307 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGE------HYCGGVIISATH 71
            |||:               ::..||:||.....||||....|..|.:      :.|.|.:|:..|
Mosquito   273 LCGL---------------SVNTRIIGGETEVPGQFPWMARLAYRNQTSGRVTYRCAGSLITNRH 322

  Fly    72 VITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP----------VAEVIMH-----PNYATG 121
            |||..|||.  |.:....|.||:.|.  |..:.|..|          :.::|.|     |.||  
Mosquito   323 VITVAHCVT--NLIDELQLVSIRLGD--LECNAVTDPRCSARYQDFAIEQIIPHESYDVPKYA-- 381

  Fly   122 GHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD---------------ISGWGNIAEKGPL 171
              ||:|:::|:. .|...||.:        |.|:..|               |:|||:.:.:...
Mosquito   382 --NDIALIKLRE-TTETYNIIS--------PLCLPTDQYAPYALNLTGQLGIIAGWGSTSNRSNT 435

  Fly   172 -SDSLLFVQVTSISRGAC-----RWMFYSRLP----ETMICLLHSKNSGACYGDSGGP------- 219
             |.:|.::::..:....|     |:...||.|    ...:|....:|..||.||||||       
Mosquito   436 PSPTLQWLRLPIVDTAGCANAYARYSVNSRNPIIVSGNQMCAQGQENRDACQGDSGGPLMNEAIS 500

  Fly   220 ----------ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
                      .::|.:..|:::.          |..|.|||....||
Mosquito   501 TRDRFVLLGLVSFGPRTCGVSNF----------PGVYTRISAYIDWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/282 (25%)
Tryp_SPc 37..219 CDD:238113 61/227 (27%)
AgaP_AGAP004149XP_313033.3 CLIP 47..92 CDD:288855
Tryp_SPc 281..537 CDD:214473 71/282 (25%)
Tryp_SPc 282..537 CDD:238113 70/281 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.