DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CLIPB5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313032.4 Gene:CLIPB5 / 1273975 VectorBaseID:AGAP004148 Length:379 Species:Anopheles gambiae


Alignment Length:299 Identity:81/299 - (27%)
Similarity:124/299 - (41%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR------LRGEHYCGGVIISATHV 72
            ||:|.               ..||.||:..:..:||....|:      :.|.| ||||:|:..:|
Mosquito   108 CGIQT---------------SDRIFGGVNTRIDEFPWIALLKYAKPNNVFGFH-CGGVLINDRYV 156

  Fly    73 ITAGHCVKHGNDVVPA--DLWSIQAG----SLLLSSDG-----------VRIPVAEVIMHPNY-- 118
            :||.||| :|.| :|:  :|..::.|    |.....:|           :.:|:...|.||.|  
Mosquito   157 LTASHCV-NGKD-IPSTWNLAEVRLGEWDTSTAQDCEGLGDDVDCSPPPIDVPIEGKIPHPEYVP 219

  Fly   119 -ATGGHNDLAVLRLQSPLTFDANIAAI------QLATEDPPNCVAVDISGWG--------NIAEK 168
             :...:||:|:||||..:.:...|..|      :|...|... ..:.::|||        |:.:|
Mosquito   220 TSAEQYNDIALLRLQQSVPYSDFIKPICLPMQAELKARDYVG-FRMQVAGWGRTATARFSNVKQK 283

  Fly   169 GPLSDSLLFVQVTSISRGACRWMFYSR----LPETMICLLHSKNSGACYGDSGGPA----TYGG- 224
                     |.|..:|..||. ..|.|    |.::.:|........:|.||||||.    |.|| 
Mosquito   284 ---------VAVDGVSLDACN-QVYQREQVLLRQSQLCAGGEAGKDSCQGDSGGPLTGVHTAGGL 338

  Fly   225 ---KVVGLASLLLGGG---CGRAA-PDGYLRISKVRAWI 256
               .::||.|.    |   ||:|. |..|.::.:...||
Mosquito   339 QYWYLIGLVSF----GPTPCGQAGWPGVYTKVDQYVDWI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/275 (28%)
Tryp_SPc 37..219 CDD:238113 61/225 (27%)
CLIPB5XP_313032.4 CLIP 33..87 CDD:288855
Tryp_SPc 115..373 CDD:214473 76/275 (28%)
Tryp_SPc 116..373 CDD:238113 75/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.