DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:254 Identity:78/254 - (30%)
Similarity:112/254 - (44%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEPRIVGGIKAKQGQFPHQISLRLR---GEHYCGGVIISATHVITAGHCVKHGNDV-VPAD 89
            :::|...|||.|.:|:.||||:|::|..:   |...||..||:..:|:||.|||..|.|. .|  
Mosquito    60 TQNAPNRRIVNGQEARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAP-- 122

  Fly    90 LWSIQAGSLLL----------SSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAA 143
               :..|:.:|          |...:....:.||.||.| .....||:||:||...:.:...|..
Mosquito   123 ---VANGTAILGAHNRMIEEPSQQRITFSSSGVIGHPGYDLFDVRNDIAVVRLDELIVYTDRIQP 184

  Fly   144 IQLATEDPPNCVA---VDISGWGNIAEKGP-LSDSLLFVQVTSISRGACR--WMFYSRLPETM-I 201
            |:|.:.......|   ..:||:|..:...| |||.|.:|....::...||  |.....|.|.. |
Mosquito   185 IRLPSRSDTRTFAGLMGTVSGYGIYSTANPALSDVLNYVLNPVMTNADCRAGWSGLEWLIEAQNI 249

  Fly   202 CLLHSKNSGACYGDSGGPATY--GGK--VVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            |........||..|||||.|.  .|:  .||:.|.....||....|..:.|::....||
Mosquito   250 CQSGDGGRAACNSDSGGPLTVQDSGESLQVGVVSFGSSVGCDNGVPTVFARVTYYLEWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/245 (31%)
Tryp_SPc 37..219 CDD:238113 63/203 (31%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 75/245 (31%)
Tryp_SPc 68..311 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.