DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CLIPD8

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312135.5 Gene:CLIPD8 / 1273182 VectorBaseID:AGAP002784 Length:588 Species:Anopheles gambiae


Alignment Length:270 Identity:89/270 - (32%)
Similarity:131/270 - (48%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR------LRGEHYCGGVIISATHV 72
            ||:|. :|:.          |.|||||..|..|::|.|:|:|      ....|.|||.:|:...:
Mosquito   333 CGIQT-MGRP----------ETRIVGGKNAPFGRWPWQVSVRRTSFFGFSSTHRCGGAVINDNWI 386

  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP-----VAEVIMHPNYATGGHN-DLAVLRL 131
            .||||||   :|::.:.: .|:.|....|....::|     ||..::||.|....:. |||:::|
Mosquito   387 ATAGHCV---DDLLTSQI-RIRVGEYDFSHVQEQLPYIERGVARKVVHPKYNFFTYEFDLALVKL 447

  Fly   132 QSPLTFDANIAAIQL-ATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF--- 192
            :.||.|..:|:.|.| ||:|........::|||.::|.|.|...|..|.|..:|...|:.||   
Mosquito   448 EQPLVFAPHISPICLPATDDLLIGENATVTGWGRLSEGGTLPSVLQEVSVPIVSNDRCKSMFLRA 512

  Fly   193 --YSRLPETMICLLH-SKNSGACYGDSGGPATYGGK-----VVGLASLLLGGGCGRA-APDGYLR 248
              :..:|:..:|..| :....:|.||||||....||     :.|:.|  .|.||..| .|....|
Mosquito   513 GRHEFIPDIFLCAGHETGGQDSCQGDSGGPLQVKGKDGHYFLAGIIS--WGIGCAEANLPGVCTR 575

  Fly   249 ISKVRAWIAE 258
            |||...||.|
Mosquito   576 ISKFVPWIME 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/244 (33%)
Tryp_SPc 37..219 CDD:238113 65/200 (33%)
CLIPD8XP_312135.5 Tryp_SPc 344..583 CDD:214473 81/244 (33%)
Tryp_SPc 345..586 CDD:238113 83/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.