DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CLIPD6

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:259 Identity:76/259 - (29%)
Similarity:118/259 - (45%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLR---GE--HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQA 95
            |:|||:.|:...:|....:..:   ||  ..|||.:|:..||:||.||::.       ||.|::.
Mosquito   232 RVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTAAHCIRR-------DLSSVRL 289

  Fly    96 GSLLLSSDG----VRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATED---PP 152
            |....|:|.    :.:||.....||:| ...||.|||||.::..:.|...|..|.|...:   ..
Mosquito   290 GEHDTSTDAETKHIDVPVVRYESHPSYDKKDGHTDLAVLYMEFEVQFSDAIKPICLPLSETIRSK 354

  Fly   153 NCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF--------YSRLPETMIC---LL 204
            |.:...  ::|||...|.|..::.|..:|:..|:...||.::        ..:....::|   :.
Mosquito   355 NFIGYTPFVAGWGRTQEGGKSANVLQELQIPIIANDECRTLYDKIGKVFSQKQFDNAVMCAGVIE 419

  Fly   205 HSKNSGACYGDSGG----PATYGGKV----VGLASLLLGGGCGRA-APDGYLRISKVRAWIAEK 259
            ..|:|  |.|||||    |..:|.:.    ||:.|  .|.||.|| .|..|.|::....||.:|
Mosquito   420 GGKDS--CQGDSGGPLMLPQRFGTEFYYYQVGIVS--YGIGCARAEVPGVYTRVASFVDWIQQK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/254 (29%)
Tryp_SPc 37..219 CDD:238113 59/211 (28%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 73/254 (29%)
Tryp_SPc 233..479 CDD:238113 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.