DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:261 Identity:84/261 - (32%)
Similarity:116/261 - (44%) Gaps:55/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPH-----QISLRLRG-------EHYCGGVIISATHVITAGHCVKHGNDVVPAD 89
            ||||..|...:|||     :..|:..|       |.:|||.:||...|:||.||...|....|. 
Mosquito    26 IVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHCAHTGMSHPPT- 89

  Fly    90 LWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG---HNDLAVLRLQSPLTFDANIAAIQLA---- 147
              .:|.|:..|....:.:.|.:|::||.|  ||   :||:|::||:||:.     ::||.|    
Mosquito    90 --VVQLGAHDLRRPALYVGVRDVVLHPGY--GGVLAYNDIALIRLESPVA-----SSIQPALLWR 145

  Fly   148 TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-SR------LPETMICLLH 205
            :|..|..|.:..:|||.:......|..|..||:..:....|..:.| ||      || :.:| ..
Mosquito   146 SETIPENVPLIATGWGKLGHFEDPSMILQRVQIPIVPNSQCNQLLYRSRRLRHGVLP-SQLC-AG 208

  Fly   206 SKNSG--ACYGDSGGP------------ATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAW 255
            ..|.|  .|.||||||            ..|...|||:.|  .||.||.. .|..|.|:|....|
Mosquito   209 DPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRYYVVGITS--NGGICGTVDRPGLYTRVSSYAGW 271

  Fly   256 I 256
            |
Mosquito   272 I 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 82/259 (32%)
Tryp_SPc 37..219 CDD:238113 67/209 (32%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 84/261 (32%)
Tryp_SPc 26..272 CDD:214473 82/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.