DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010662

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_311382.4 Gene:AgaP_AGAP010662 / 1272470 VectorBaseID:AGAP010662 Length:584 Species:Anopheles gambiae


Alignment Length:245 Identity:66/245 - (26%)
Similarity:101/245 - (41%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDV--AQNQSESAIEPRIV-------GGIKAKQGQFPHQISLRLRG------E 59
            :|||..|:....||.  ..:.:::....|:|       ||...:.|.:|...:|..||      |
Mosquito     4 ILLLHNVRYSFAQDELHINDYNDNECGERMVKRKGLVKGGYSTQPGDWPWHAALYHRGINSAGFE 68

  Fly    60 HYCGGVIISATHVITAGHCVKHGND--VVPADLWSIQAGSLLLSSD----GVRIPVAEVIMHPNY 118
            :.|||.|:....|:||.|||.....  .:||:...::.|...|.::    .....|.|.|||..|
Mosquito    69 YACGGSIVHRYLVLTAAHCVTLATSRRKIPAENMQLRLGRFNLMNNEEEYAEEFDVIETIMHEGY 133

  Fly   119 -ATGGHNDLAVLRLQSPLTFDANIAAIQLATED----------PPNCVAVDISGWGNIAEKGPLS 172
             .|...||:|:||::.|:.|:..|..:.|...|          .|..|.    ||| ::|...:.
Mosquito   134 RPTTFENDIAILRVEIPIIFNDYIQPVCLWKRDDGVVLPWFYNQPGTVV----GWG-LSEDNMIG 193

  Fly   173 DSLLFVQVTSISRGAC----RWMFYSRLPETMICLLHSKNSGACYGDSGG 218
            .:|...::..:....|    |..|...|.....|..:...:|.|.|||||
Mosquito   194 TTLNEARMPVVDSWTCLASDRAFFGKFLQSKAFCAGYKNGTGVCNGDSGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/217 (28%)
Tryp_SPc 37..219 CDD:238113 59/216 (27%)
AgaP_AGAP010662XP_311382.4 Tryp_SPc 42..292 CDD:238113 58/207 (28%)
Tryp_SPc 42..289 CDD:214473 58/207 (28%)
Tryp_SPc 334..578 CDD:214473
Tryp_SPc 334..578 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.