DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP003807

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_310364.7 Gene:AgaP_AGAP003807 / 1271545 VectorBaseID:AGAP003807 Length:278 Species:Anopheles gambiae


Alignment Length:251 Identity:81/251 - (32%)
Similarity:125/251 - (49%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDVAQNQSESAIEP-------RIVGGIKAKQGQFPHQISLRLRGE-HYCGGVIISATHVITAGHC 78
            |.:....:.:|:.|       |||||..|.:||||||:|||.... |:|||.||....:|:|.||
Mosquito    33 QSIFSTVNRAAVLPASGSKGGRIVGGYDATEGQFPHQVSLRRPPNFHFCGGSIIGPRWIISATHC 97

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIA 142
            .   ..:.||:| ::..||:.|:|.||......::.||.|.... .||:::::...|:.|:.:..
Mosquito    98 T---IGMEPANL-NVYVGSVKLASGGVYYRTMRIVNHPLYDPNTIENDISLIQTVQPIVFNEHTQ 158

  Fly   143 AIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLP------ETMI 201
            .|.||:.:..:.....|||||   ....:.|:|.::.|..::...||    :..|      :::|
Mosquito   159 PIGLASTNLISATGASISGWG---RSNVILDNLQYMNVNILTMEECR----AERPGSGNIFDSVI 216

  Fly   202 CLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIA 257
            |:......|||.||||||..|.|.:.|:|| .:...|.....|.|.|:....:|||
Mosquito   217 CVSSPFGQGACSGDSGGPLIYDGMLHGIAS-FVRVPCATEVSDVYERVYSHLSWIA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/227 (33%)
Tryp_SPc 37..219 CDD:238113 63/189 (33%)
AgaP_AGAP003807XP_310364.7 Tryp_SPc 54..270 CDD:214473 75/227 (33%)
Tryp_SPc 55..273 CDD:238113 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.