DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006869

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_308888.1 Gene:AgaP_AGAP006869 / 1270209 VectorBaseID:AGAP006869 Length:272 Species:Anopheles gambiae


Alignment Length:277 Identity:90/277 - (32%)
Similarity:138/277 - (49%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSE------SAIEP----RIVGGIKAKQGQFPHQISLRLRGEH 60
            |.|:.||:........:|:.|::..      ..|.|    |||||.:|....||:|:|||..|.|
Mosquito     6 WFVVALLIGSSLAGWEEDLYQSKRRLPSGLVLPIAPPTSGRIVGGFEANIADFPYQLSLRQNGAH 70

  Fly    61 YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN- 124
            .||..:||:.:.::|.||.   ....|....:::.||...::.||....||:|.||:|:....: 
Mosquito    71 ICGASVISSNYALSAAHCT---FPAPPVAAITLRGGSTDRTAGGVVFQTAEIINHPSYSDSSLDF 132

  Fly   125 DLAVLRLQSPLTFDANIAAIQLATE--DPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGA 187
            |:.|:|:.:... .||||.|.||.|  |.|......:||||..:..|.|..:|..|:|..||:.:
Mosquito   133 DVCVIRITTSFV-GANIAPITLAPEGTDYPEGTRTMVSGWGATSAIGALPINLQAVEVPLISQES 196

  Fly   188 CRWMF-YSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLAS----LLLGGGCGRAAPDGYL 247
            ||.:: .:.:.:.|:| .......||.||||||.|..|:.:|:.|    |.||.     .|..|.
Mosquito   197 CRGVWGAASVTDNMVC-ASEPGRDACGGDSGGPLTNNGRQIGIVSWGSPLCLGN-----LPGVYA 255

  Fly   248 RIS--KVRAWIAEKAGL 262
            |::  .:||:|.:.|.:
Mosquito   256 RVAAPSIRAFIRDNANV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 80/229 (35%)
Tryp_SPc 37..219 CDD:238113 65/185 (35%)
AgaP_AGAP006869XP_308888.1 Tryp_SPc 46..259 CDD:214473 78/222 (35%)
Tryp_SPc 47..258 CDD:238113 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.