DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC116407662

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031749278.1 Gene:LOC116407662 / 116407662 -ID:- Length:329 Species:Xenopus tropicalis


Alignment Length:299 Identity:83/299 - (27%)
Similarity:122/299 - (40%) Gaps:69/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WTTLWTVLLLLLCGV----------QVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL 56
            |..|...||||..|:          ..:.|:.|....       |||||..:|:||.|.|..:..
 Frog     3 WFHLIRALLLLNLGIYGFAKEEAKLSKVCGKPVVDRS-------RIVGGQDSKKGQHPWQAIVWH 60

  Fly    57 RGEHYCGGVIISATHVITAGHCVKHGND---VVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY 118
            ..:..|||.:||:.:|:||..|::..||   :|....::|...    ..:.|.:.|..:|:|..|
 Frog    61 PSKVRCGGTLISSRYVLTAAQCLESENDTSVIVILGAYNITGN----HKEEVSVKVNRIILHHRY 121

  Fly   119 ATGGH-NDLAVLRLQSPLTFDANIAAIQL---ATEDPP--NCVAVDISGWGN------------I 165
            ..... .|:|:|.|.:.:.|...|....|   .||..|  :|:   ::|||:            :
 Frog   122 NDSDFPYDIALLELSNSVPFTDFILPACLPPFPTEFLPGHSCL---VTGWGDTDYDSTKPKPVIL 183

  Fly   166 AEKGPLSDSLLFVQVTSISRGACRWMFY-----SRLPETMICL--LHSKNSGACYGDSGGP-ATY 222
            .|.|          |..|....||.::.     |.:.|.|.|.  :|.|.| .|.||.||| ..:
 Frog   184 QEAG----------VRLIDLQHCRDLYKLVTNDSIITENMTCAMDIHGKRS-FCRGDGGGPLVCH 237

  Fly   223 GGK---VVGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            .|:   :||:.|  .|.|||...|..|..:.....||.|
 Frog   238 AGEQWFLVGVVS--FGYGCGHGIPGVYTSVPAYVDWIKE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/251 (28%)
Tryp_SPc 37..219 CDD:238113 58/209 (28%)
LOC116407662XP_031749278.1 Tryp_SPc 41..275 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.