DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss28

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:126/272 - (46%) Gaps:30/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRG------EHYCGGVI 66
            :||.|.|....:....|:.::|:..   .||||.....|::|.|:|||:..      .|.|||.|
Mouse     5 LLLALSCLESTVFMASVSISRSKPV---GIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSI 66

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLR 130
            |....::||.||:: ..|..|| ::.:|.|.:.|..:...:.::.:|:||:| ......|||:::
Mouse    67 IHPQWILTAAHCIQ-SQDADPA-VYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQ 129

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVD---ISGWGNIAEKGPLSD--SLLFVQVTSISRGACRW 190
            |.:.|....|::.:.| .:|.....:.|   :.||||:.::.||..  .|..|::......:|:.
Mouse   130 LTALLVTSTNVSPVSL-PKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKR 193

  Fly   191 MFYSR---------LPETMICLLHSKNSGACYGDSGGPAT--YGGKVVGLASLLLGGGCGRAAPD 244
            .:..:         :.:.|:| ..:...|.|:||||||..  ...|.:.:..:..|..|....|.
Mouse   194 AYRKKSSDEHKAVAIFDDMLC-AGTSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSNNLPS 257

  Fly   245 GYLRISKVRAWI 256
            .:.|:....|||
Mouse   258 IFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/242 (26%)
Tryp_SPc 37..219 CDD:238113 56/202 (28%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 66/243 (27%)
Tryp_SPc 31..269 CDD:214473 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.